Sequence Analysis

DNA to Protein Translation

Six reading frames and the open reading frames in them, in any of the NCBI genetic codes.

An example is loaded. Click here and it clears.

Examples:
Settings

Gaps and digits are removed before translating; U is read as T. A codon whose ambiguity codes all give the same residue is translated, and any other is X. ORF positions count along the sequence you pasted, so a minus-strand ORF counts down.

Six reading frames

+1GTRSRPWLAIDMKQTHLVDRAFSNGWIEPCYKTLVGDAHNRQSEIFMWPKLTVGADYNRHQSCEIFLM*AAA*LRIL*SR

+2VPGLDHG*RSI*NRLILWIVLSATDGSNHVTKLLWEMLITVRAKSSCGQNLLWELITTVIRAVKSSLCKRPLN*GSSRVD

+3YQV*TMVSDRYETDSSCGSCFQQRMDRTMLQNSCGRCS*PSERNLHVAKTYCGS*LQPSSEL*NLPYVSGRLIKDPLES

-1VDSRGSLIKRPLT*GRFHSSDDGCNQLPQ*VLAT*RFRSDGYEHLPQEFCNMVRSIRC*KHDPQDESVSYRSLTMV*TWY

-2STLEDP*LSGRLHKEDFTALMTVVISSHSKFWPHEDFALTVMSISHKSFVTWFDPSVAESTIHKMSLFHIDR*PWSRPGT

-3RL*RILN*AAAYIRKISQL**RL*SAPTVSFGHMKISL*RL*ASPTRVL*HGSIHPLLKARSTR*VCFISIANHGLDLV

Open reading frames (4)

FramePositionLength (nt)StartProtein
+134..207174ATGMKQTHLVDRAFSNGWIEPCYKTLVGDAHNRQSEIFMWPKLTVGADYNRHQSCEIFLM
-2180..22159ATGMTVVISSHSKFWPHEDFALTVMSISHKSFVTWFDPSVAESTIHKMSLFHIDR
+2110..223114ATGMLITVRAKSSCGQNLLWELITTVIRAVKSSLCKRPLN
+318..119102ATGMVSDRYETDSSCGSCFQQRMDRTMLQNSCGRCS

How to use it

  1. Paste a nucleotide sequence or FASTA. Numbers, spaces and line breaks are ignored.
  2. Pick the genetic code if it is not the standard one. The number beside each name is the transl_table value a GenBank record carries.
  3. Read the six frames, then the open reading frames underneath, which are sorted longest first.

Worth knowing

  • All the genetic code tables NCBI publishes are here, taken from the file it publishes for programs to read rather than typed out by hand.
  • An ambiguous codon becomes a residue only when every base it could be gives the same one. GGN is glycine; TGR is X, because it is either a stop or tryptophan and guessing would invent your protein.
  • Positions count along the sequence you pasted, so an ORF on the minus strand starts at a higher number than it ends. A frame that runs off the end is kept and marked rather than dropped, because pasting a partial coding sequence is ordinary.

Questions

The other sequence tools